PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0036s0087.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 173aa    MW: 19684.6 Da    PI: 4.8178
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0036s0087.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.2e-31109167159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDg++WrKYG+K+vk+s++pr+YY+C+ ++Cpvkk+ver++edp++v++tYeg Hnh 
  Kalax.0036s0087.1.p 109 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVEECPVKKRVERDREDPRYVITTYEGVHNHM 167
                          59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-3395169IPR003657WRKY domain
SuperFamilySSF1182905.49E-28102169IPR003657WRKY domain
PROSITE profilePS5081130.848104169IPR003657WRKY domain
SMARTSM007741.4E-35109168IPR003657WRKY domain
PfamPF031061.6E-24110166IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MDGNSSDYHN QNMHMSFGSL DCGEVSRAIF ANNEYLLDDW FIESGESEVT GQELGQQDPV  60
YQMNQVNGLE VNYNAQDEET DTRESGGRTG SAPVKSKVAF KTKSEIEILD DGFKWRKYGK  120
KMVKNSPNPR NYYKCSVEEC PVKKRVERDR EDPRYVITTY EGVHNHMSPS GY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-2699170778Probable WRKY transcription factor 4
1wj2_A8e-2699170778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884439.16e-49PREDICTED: probable WRKY transcription factor 50
TrEMBLA5AQ484e-49A5AQ48_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g01470.t012e-48(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.19e-44WRKY DNA-binding protein 50